SCOPe 2.03: Domain d4lhud1: 4lhu D:5-120

Lineage for d4lhud1 (4lhu D:5-120)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d4lhud1: 4lhu D:5-120 [228085]
   Other proteins in same PDB: d4lhua1, d4lhub_, d4lhug2
   automated match to d1hxma1
   complexed with bma, cl, jls, mg, nag

Details for d4lhud1

PDB Entry: 4lhu, 2.87 Å

PDB Description: crystal structure of 9c2 tcr bound to cd1d

PDB Compounds: (D:) 9C2 TCR delta chain

SCOPe Domain Sequences for d4lhud1:

Sequence; same for both SEQRES and ATOM records:

>d4lhud1 b.1.1.0 (D:5-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkvtqaqssvsmpvrkavtlnclyetswwsyyifwykqlpskemiflirqgsdeqnaksg
rysvnfkkaaksvaltisalqledsakyfcalgdpgglntdklifgkgtrvtvepr

Timeline for d4lhud1:

• d4lhud1 is new in SCOPe 2.03-stable
  
• d4lhud1 appears in SCOPe 2.04
  
• d4lhud1 appears in the current release, SCOPe 2.08