Lineage for d4lhud1 (4lhu D:5-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758036Domain d4lhud1: 4lhu D:5-120 [228085]
    Other proteins in same PDB: d4lhua1, d4lhub1, d4lhub2, d4lhug2
    automated match to d1hxma1
    complexed with bma, cl, jls, mg, nag

Details for d4lhud1

PDB Entry: 4lhu (more details), 2.87 Å

PDB Description: crystal structure of 9c2 tcr bound to cd1d
PDB Compounds: (D:) 9C2 TCR delta chain

SCOPe Domain Sequences for d4lhud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhud1 b.1.1.0 (D:5-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkvtqaqssvsmpvrkavtlnclyetswwsyyifwykqlpskemiflirqgsdeqnaksg
rysvnfkkaaksvaltisalqledsakyfcalgdpgglntdklifgkgtrvtvepr

SCOPe Domain Coordinates for d4lhud1:

Click to download the PDB-style file with coordinates for d4lhud1.
(The format of our PDB-style files is described here.)

Timeline for d4lhud1: