Lineage for d3pclm_ (3pcl M:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55519Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 55707Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 55708Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins)
  6. 55817Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 55824Species Pseudomonas aeruginosa [TaxId:287] [49490] (15 PDB entries)
  8. 55897Domain d3pclm_: 3pcl M: [22808]
    Other proteins in same PDB: d3pcla_, d3pclb_, d3pclc_, d3pcld_, d3pcle_, d3pclf_

Details for d3pclm_

PDB Entry: 3pcl (more details), 2.15 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 2-hydroxyisonicotinic acid n-oxide and cyanide

SCOP Domain Sequences for d3pclm_:

Sequence, based on SEQRES records: (download)

>d3pclm_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas aeruginosa}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pclm_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas aeruginosa}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOP Domain Coordinates for d3pclm_:

Click to download the PDB-style file with coordinates for d3pclm_.
(The format of our PDB-style files is described here.)

Timeline for d3pclm_: