Lineage for d4l1pa_ (4l1p A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1785390Superfamily b.34.21: Plus3-like [159042] (1 family) (S)
    automatically mapped to Pfam PF03126
  5. 1785391Family b.34.21.1: Plus3 [159043] (2 proteins)
    Pfam PF03126
  6. 1785398Protein automated matches [228071] (1 species)
    not a true protein
  7. 1785399Species Human (Homo sapiens) [TaxId:9606] [228072] (1 PDB entry)
  8. 1785400Domain d4l1pa_: 4l1p A: [228073]
    automated match to d2bzea1
    complexed with gol

Details for d4l1pa_

PDB Entry: 4l1p (more details), 2.12 Å

PDB Description: crystal structure of human rtf1 plus3 domain
PDB Compounds: (A:) RNA polymerase-associated protein RTF1 homolog

SCOPe Domain Sequences for d4l1pa_:

Sequence, based on SEQRES records: (download)

>d4l1pa_ b.34.21.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeitgvve
takvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptld
einkkelsikeal

Sequence, based on observed residues (ATOM records): (download)

>d4l1pa_ b.34.21.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigipvyrvaeitgvvetakvyq
lggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptldeinkke
lsikeal

SCOPe Domain Coordinates for d4l1pa_:

Click to download the PDB-style file with coordinates for d4l1pa_.
(The format of our PDB-style files is described here.)

Timeline for d4l1pa_: