![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.21: Plus3-like [159042] (1 family) ![]() automatically mapped to Pfam PF03126 |
![]() | Family b.34.21.1: Plus3 [159043] (2 proteins) Pfam PF03126 |
![]() | Protein automated matches [228071] (1 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [228072] (1 PDB entry) |
![]() | Domain d4l1pa_: 4l1p A: [228073] automated match to d2bzea1 complexed with gol |
PDB Entry: 4l1p (more details), 2.12 Å
SCOPe Domain Sequences for d4l1pa_:
Sequence, based on SEQRES records: (download)
>d4l1pa_ b.34.21.1 (A:) automated matches {Homo sapiens [TaxId: 9606]} hmvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeitgvve takvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptld einkkelsikeal
>d4l1pa_ b.34.21.1 (A:) automated matches {Homo sapiens [TaxId: 9606]} hmvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigipvyrvaeitgvvetakvyq lggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptldeinkke lsikeal
Timeline for d4l1pa_: