Lineage for d4kxhd_ (4kxh D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928145Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. 2928436Species Human (Homo sapiens), des1-7 [TaxId:9606] [54080] (8 PDB entries)
  8. 2928449Domain d4kxhd_: 4kxh D: [228070]
    automated match to d2q4gx_
    complexed with cl, na, so4

Details for d4kxhd_

PDB Entry: 4kxh (more details), 2.7 Å

PDB Description: the x-ray crystal structure of a dimeric variant of human pancreatic ribonuclease
PDB Compounds: (D:) ribonuclease pancreatic

SCOPe Domain Sequences for d4kxhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kxhd_ d.5.1.1 (D:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]}
kesrakkfqrqhmdsssstycnqmmrrrnmtqgrckpvntfvheplvdvqnvcfqekvtc
kngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasve

SCOPe Domain Coordinates for d4kxhd_:

Click to download the PDB-style file with coordinates for d4kxhd_.
(The format of our PDB-style files is described here.)

Timeline for d4kxhd_: