| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
| Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
| Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species) |
| Species Human (Homo sapiens), des1-7 [TaxId:9606] [54080] (8 PDB entries) |
| Domain d4kxha_: 4kxh A: [228069] automated match to d2q4gx_ complexed with cl, na, so4 |
PDB Entry: 4kxh (more details), 2.7 Å
SCOPe Domain Sequences for d4kxha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kxha_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]}
kesrakkfqrqhmdsssstycnqmmrrrnmtqgrckpvntfvheplvdvqnvcfqekvtc
kngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasve
Timeline for d4kxha_: