SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4kerd_ (4ker D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084960Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2084961Protein automated matches [190150] (24 species)
    not a true protein
  7. 2085109Species Sulfolobus solfataricus [TaxId:2287] [188418] (10 PDB entries)
  8. 2085137Domain d4kerd_: 4ker D: [228061]
    automated match to d2vc7a_
    complexed with co, edo, fe2, gol, peg

Details for d4kerd_

PDB Entry: 4ker (more details), 2.6 Å

PDB Description: Crystal structure of SsoPox W263V
PDB Compounds: (D:) aryldialkylphosphatase

SCOPe Domain Sequences for d4kerd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kerd_ c.1.9.0 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg
vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
rlikdgysdkimishdycctidvgtakpeykpklaprwsitlifedtipflkrngvneev
iatifkenpkkffs

SCOPe Domain Coordinates for d4kerd_:

Click to download the PDB-style file with coordinates for d4kerd_.
(The format of our PDB-style files is described here.)

Timeline for d4kerd_: