| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4jfxl1: 4jfx L:1-107 [228053] Other proteins in same PDB: d4jfxa2, d4jfxb_, d4jfxh_, d4jfxl2 automated match to d4jfzl1 complexed with pg4 |
PDB Entry: 4jfx (more details), 1.95 Å
SCOPe Domain Sequences for d4jfxl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jfxl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspatlslspgeratlscmtstdidddmnwyqqkpgqaprllisegntlrpgvpa
rfsgsgsgtdftltisslepedfavyyclqsfnvpltfgqgtkveik
Timeline for d4jfxl1:
View in 3DDomains from other chains: (mouse over for more information) d4jfxa1, d4jfxa2, d4jfxb_, d4jfxh_ |