Lineage for d4jh2b_ (4jh2 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2942891Species Bacillus cereus [TaxId:222523] [228045] (9 PDB entries)
  8. 2942893Domain d4jh2b_: 4jh2 B: [228048]
    automated match to d4jd1b_
    complexed with fmt, mg, so4, zn

Details for d4jh2b_

PDB Entry: 4jh2 (more details), 1.27 Å

PDB Description: Crystal Structure of FosB from Bacillus cereus with Zinc and Sulfate at 1.27 A Resolution
PDB Compounds: (B:) Metallothiol transferase FosB

SCOPe Domain Sequences for d4jh2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jh2b_ d.32.1.0 (B:) automated matches {Bacillus cereus [TaxId: 222523]}
mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
lqdrlnyyredkphmtfy

SCOPe Domain Coordinates for d4jh2b_:

Click to download the PDB-style file with coordinates for d4jh2b_.
(The format of our PDB-style files is described here.)

Timeline for d4jh2b_: