SCOPe 2.08: Domain d4j20b_: 4j20 B:

Lineage for d4j20b_ (4j20 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (26 species)
   not a true protein

7. Species Chlorobium tepidum [TaxId:194439] [228039] (1 PDB entry)

8. Domain d4j20b_: 4j20 B: [228041]
   automated match to d2v08a_
   complexed with heb, ipa, na, so4

Details for d4j20b_

PDB Entry: 4j20, 1.3 Å

PDB Description: X-ray structure of the cytochrome c-554 from chlorobaculum tepidum

PDB Compounds: (B:) Cytochrome c-555

SCOPe Domain Sequences for d4j20b_:

Sequence; same for both SEQRES and ATOM records:

>d4j20b_ a.3.1.0 (B:) automated matches {Chlorobium tepidum [TaxId: 194439]}
stydaaagkatydascatchktgmmgapkvgdkaawapriaqgmntlvsksikgykgtkg
mmpakggnakltdaqvgnavaymvgqsk

Timeline for d4j20b_:

• d4j20b_ first appeared in SCOPe 2.03
  
• d4j20b_ appears in SCOPe 2.07