| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
| Protein automated matches [190453] (26 species) not a true protein |
| Species Chlorobium tepidum [TaxId:194439] [228039] (1 PDB entry) |
| Domain d4j20a_: 4j20 A: [228040] automated match to d2v08a_ complexed with heb, ipa, na, so4 |
PDB Entry: 4j20 (more details), 1.3 Å
SCOPe Domain Sequences for d4j20a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j20a_ a.3.1.0 (A:) automated matches {Chlorobium tepidum [TaxId: 194439]}
stydaaagkatydascatchktgmmgapkvgdkaawapriaqgmntlvsksikgykgtkg
mmpakggnakltdaqvgnavaymvgqsk
Timeline for d4j20a_: