SCOPe 2.05: Domain d4hzga_: 4hzg A:

Lineage for d4hzga_ (4hzg A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (4 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:1831] [189207] (7 PDB entries)

8. Domain d4hzga_: 4hzg A: [228036]
   automated match to d4kaja_
   complexed with cl

Details for d4hzga_

PDB Entry: 4hzg, 1.95 Å

PDB Description: structure of haloalkane dehalogenase dhaa from rhodococcus rhodochrous

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d4hzga_:

Sequence; same for both SEQRES and ATOM records:

>d4hzga_ c.69.1.8 (A:) automated matches {Rhodococcus sp. [TaxId: 1831]}
eigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrci
apdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnper
vkgiacmefirpiptwdewpefaretfqafrtadvgreliidqnafiegalpkcvvrplt
evemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwgt
pgvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpalhhh

Timeline for d4hzga_:

• d4hzga_ first appeared in SCOPe 2.03
  
• d4hzga_ appears in SCOPe 2.04
  
• d4hzga_ is called d4hzga1 in SCOPe 2.06
  
• d4hzga_ appears in the current release, SCOPe 2.08, called d4hzga1