Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein automated matches [190177] (6 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [194701] (5 PDB entries) |
Domain d4hnsa_: 4hns A: [228035] automated match to d3chya_ complexed with bef, mg |
PDB Entry: 4hns (more details), 2.1 Å
SCOPe Domain Sequences for d4hnsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hnsa_ c.23.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]} anknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp gmqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekld kife
Timeline for d4hnsa_: