| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein automated matches [190177] (9 species) not a true protein |
| Species Vibrio cholerae [TaxId:666] [194701] (5 PDB entries) |
| Domain d4hnqa1: 4hnq A:6-128 [228034] Other proteins in same PDB: d4hnqa2 automated match to d3chya_ complexed with mg; mutant |
PDB Entry: 4hnq (more details), 2.4 Å
SCOPe Domain Sequences for d4hnqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hnqa1 c.23.1.1 (A:6-128) automated matches {Vibrio cholerae [TaxId: 666]}
nknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmpg
mqgidllkniradeelkhlpvlmitaeakreaiieaaqagvngyivkpftaatlkekldk
ife
Timeline for d4hnqa1: