Lineage for d4hnqa1 (4hnq A:6-128)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855710Protein automated matches [190177] (9 species)
    not a true protein
  7. 2855772Species Vibrio cholerae [TaxId:666] [194701] (5 PDB entries)
  8. 2855776Domain d4hnqa1: 4hnq A:6-128 [228034]
    Other proteins in same PDB: d4hnqa2
    automated match to d3chya_
    complexed with mg; mutant

Details for d4hnqa1

PDB Entry: 4hnq (more details), 2.4 Å

PDB Description: Crystal Structure of the mutant Q97A of Vibrio cholerae CheY3
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d4hnqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hnqa1 c.23.1.1 (A:6-128) automated matches {Vibrio cholerae [TaxId: 666]}
nknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmpg
mqgidllkniradeelkhlpvlmitaeakreaiieaaqagvngyivkpftaatlkekldk
ife

SCOPe Domain Coordinates for d4hnqa1:

Click to download the PDB-style file with coordinates for d4hnqa1.
(The format of our PDB-style files is described here.)

Timeline for d4hnqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hnqa2