Lineage for d4hnra_ (4hnr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856184Species Vibrio cholerae [TaxId:345073] [226740] (2 PDB entries)
  8. 2856186Domain d4hnra_: 4hnr A: [228033]
    automated match to d4h60a_
    complexed with so4

Details for d4hnra_

PDB Entry: 4hnr (more details), 1.9 Å

PDB Description: High resolution structure of Chemotaxis response regulator CheY4 of Vibrio cholerae
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d4hnra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hnra_ c.23.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 345073]}
tmakvlavddsisirqmvshtlqdagyevetaadgrealakaqkarfdviisdvnmpvmt
gfefvkavrmqsqykftpilmlttetspekkqegkavgatgwlvkpfnpetllktlqrvl

SCOPe Domain Coordinates for d4hnra_:

Click to download the PDB-style file with coordinates for d4hnra_.
(The format of our PDB-style files is described here.)

Timeline for d4hnra_: