Lineage for d4c4ma_ (4c4m A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956780Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2956781Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2956786Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
    automatically mapped to Pfam PF01085
  6. 2956800Protein automated matches [190324] (2 species)
    not a true protein
  7. 2956827Species Mouse (Mus musculus) [TaxId:10090] [228020] (2 PDB entries)
  8. 2956828Domain d4c4ma_: 4c4m A: [228021]
    automated match to d1vhha_
    complexed with act, ca, zn

Details for d4c4ma_

PDB Entry: 4c4m (more details), 1.74 Å

PDB Description: crystal structure of the sonic hedgehog-chondroitin-4-sulphate complex
PDB Compounds: (A:) Sonic hedgehog protein

SCOPe Domain Sequences for d4c4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c4ma_ d.65.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrlm
tqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsky
gmlarlaveagfdwvyyeskahihcsvkaensva

SCOPe Domain Coordinates for d4c4ma_:

Click to download the PDB-style file with coordinates for d4c4ma_.
(The format of our PDB-style files is described here.)

Timeline for d4c4ma_: