SCOPe 2.04: Domain d4bndb_: 4bnd B:

Lineage for d4bndb_ (4bnd B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (45 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:416870] [228017] (1 PDB entry)

8. Domain d4bndb_: 4bnd B: [228019]
   automated match to d3f9ra_
   complexed with gol, so4

Details for d4bndb_

PDB Entry: 4bnd, 1.5 Å

PDB Description: Structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases

PDB Compounds: (B:) alpha-phosphoglucomutase

SCOPe Domain Sequences for d4bndb_:

Sequence; same for both SEQRES and ATOM records:

>d4bndb_ c.108.1.0 (B:) automated matches {Lactococcus lactis [TaxId: 416870]}
amkkilsfdidntlnepkmpifpemaellatlsqkyiiapisgqkydqfliqiinnlpes
anldnfhlfvaqgtqyyahkagewkqvfnyaltdeqanaimgalekaakelghwdesvll
pgdeinenresmiaysaigqkagveakqawdpdmtkrneiaklasqyapefefevagttt
ingfvpgqnkefgmnhlmeelnvtkeeilyfgdmtqpggndypvvqmgietitvrdwket
aailkaiiameea

Timeline for d4bndb_:

• d4bndb_ first appeared in SCOPe 2.03
  
• d4bndb_ appears in SCOPe 2.05
  
• d4bndb_ appears in the current release, SCOPe 2.08, called d4bndb1