![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Lactococcus lactis [TaxId:416870] [228017] (1 PDB entry) |
![]() | Domain d4bnda1: 4bnd A:1-251 [228018] Other proteins in same PDB: d4bnda2, d4bndb2 automated match to d3f9ra_ complexed with gol, so4 |
PDB Entry: 4bnd (more details), 1.5 Å
SCOPe Domain Sequences for d4bnda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bnda1 c.108.1.0 (A:1-251) automated matches {Lactococcus lactis [TaxId: 416870]} mkkilsfdidntlnepkmpifpemaellatlsqkyiiapisgqkydqfliqiinnlpesa nldnfhlfvaqgtqyyahkagewkqvfnyaltdeqanaimgalekaakelghwdesvllp gdeinenresmiaysaigqkagveakqawdpdmtkrneiaklasqyapefefevagttti ngfvpgqnkefgmnhlmeelnvtkeeilyfgdmtqpggndypvvqmgietitvrdwketa ailkaiiamee
Timeline for d4bnda1: