Lineage for d4bnda1 (4bnd A:1-251)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920537Species Lactococcus lactis [TaxId:416870] [228017] (1 PDB entry)
  8. 2920538Domain d4bnda1: 4bnd A:1-251 [228018]
    Other proteins in same PDB: d4bnda2, d4bndb2
    automated match to d3f9ra_
    complexed with gol, so4

Details for d4bnda1

PDB Entry: 4bnd (more details), 1.5 Å

PDB Description: Structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases
PDB Compounds: (A:) alpha-phosphoglucomutase

SCOPe Domain Sequences for d4bnda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bnda1 c.108.1.0 (A:1-251) automated matches {Lactococcus lactis [TaxId: 416870]}
mkkilsfdidntlnepkmpifpemaellatlsqkyiiapisgqkydqfliqiinnlpesa
nldnfhlfvaqgtqyyahkagewkqvfnyaltdeqanaimgalekaakelghwdesvllp
gdeinenresmiaysaigqkagveakqawdpdmtkrneiaklasqyapefefevagttti
ngfvpgqnkefgmnhlmeelnvtkeeilyfgdmtqpggndypvvqmgietitvrdwketa
ailkaiiamee

SCOPe Domain Coordinates for d4bnda1:

Click to download the PDB-style file with coordinates for d4bnda1.
(The format of our PDB-style files is described here.)

Timeline for d4bnda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bnda2