Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:176299] [226505] (8 PDB entries) |
Domain d4mmwb1: 4mmw B:1-126 [228011] Other proteins in same PDB: d4mmwa2, d4mmwb2 automated match to d4hcha1 complexed with cl, llh, mg, pge, xyh |
PDB Entry: 4mmw (more details), 1.65 Å
SCOPe Domain Sequences for d4mmwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mmwb1 d.54.1.0 (B:1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv ykligg
Timeline for d4mmwb1: