Lineage for d4mlca_ (4mlc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144105Species Desulfitobacterium hafniense [TaxId:272564] [228009] (2 PDB entries)
  8. 2144107Domain d4mlca_: 4mlc A: [228010]
    automated match to d3ipca_
    complexed with ca, so4

Details for d4mlca_

PDB Entry: 4mlc (more details), 2.71 Å

PDB Description: ABC Transporter Substrate-Binding Protein fromDesulfitobacterium hafniense
PDB Compounds: (A:) Extracellular ligand-binding receptor

SCOPe Domain Sequences for d4mlca_:

Sequence, based on SEQRES records: (download)

>d4mlca_ c.93.1.0 (A:) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
eeifigvawpfaslddlfaeglelavqeineqggvqgrklslvkaddeaelekglaiaqa
fadnagiqavighrnsfisipaasiydqaglvmlspastspdltdhgyihvfrnipsdqe
iarqlaiylaeqghermviyytddsygnglanafedyaraqgitivdrfnyygnlkdler
lydkwqafgmdgifiaktatgggteflvdaksvgievpliagnswdalsltedienigmt
aegllvgsffnpqrpdsrtqdfveafrreygqpptsyaaagydavillaealeksdlthp
atlaqglrdlgpwegvmgmhrfdgrgddigdlvvlkkmkdgrfeyl

Sequence, based on observed residues (ATOM records): (download)

>d4mlca_ c.93.1.0 (A:) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
eeifigvawpfaslddlfaeglelavqeineqggvqgrklslvkaddeaelekglaiaqa
fadnagiqavighrnsfisipaasiydqaglvmlspastspdltdhgyihvfrnipsdqe
iarqlaiylaeqghermviyytddsygnglanafedyaraqgitivdrfnyygnlkdler
lydkwqafgmdgifiaktatgggteflvdaksvgievpliagnswdagmtaegllvgsff
npqrpdsrtqdfveafrreygqpptsyaaagydavillaealeksdlthpatlaqglrdl
gpwegvmgmhrfdgrgddigdlvvlkkmkdgrfeyl

SCOPe Domain Coordinates for d4mlca_:

Click to download the PDB-style file with coordinates for d4mlca_.
(The format of our PDB-style files is described here.)

Timeline for d4mlca_: