Lineage for d4mi2b_ (4mi2 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100284Species Mycobacterium abscessus [TaxId:561007] [189671] (6 PDB entries)
  8. 2100289Domain d4mi2b_: 4mi2 B: [227990]
    automated match to d3moya_

Details for d4mi2b_

PDB Entry: 4mi2 (more details), 2.3 Å

PDB Description: Crystal structure of putative Enoyl-CoA hydratase/isomerase from Mycobacterium abscessus
PDB Compounds: (B:) Putative enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d4mi2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mi2b_ c.14.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
aavaysvnhagvaaivldrpeasnaldrtmktellqallaaggdpavravvmsaagknfc
vgqdlaehvealrddpahamdtvrehynpvlealdaikvpvvvaingacvgaglglalga
diriagqrakfgtaftgiglaadsalsaslprligasratamfllgdtidaptahtwglv
hevvdegspadvansvagrlaggptaafsevkellrrnavaplgdvlereasaqqrlgas
rdhsaaveaflakdkpvfvgr

SCOPe Domain Coordinates for d4mi2b_:

Click to download the PDB-style file with coordinates for d4mi2b_.
(The format of our PDB-style files is described here.)

Timeline for d4mi2b_: