SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4lyda_ (4lyd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (77 species)
    not a true protein
  7. 2136645Species Sphingomonas wittichii [TaxId:392499] [227977] (5 PDB entries)
  8. 2136648Domain d4lyda_: 4lyd A: [227980]
    automated match to d2rhwa_
    mutant

Details for d4lyda_

PDB Entry: 4lyd (more details), 2.26 Å

PDB Description: Crystal structure of the S105A mutant of a C-C hydrolase, DxnB2 from Sphingomonas wittichii RW1
PDB Compounds: (A:) MCP Hydrolase

SCOPe Domain Sequences for d4lyda_:

Sequence, based on SEQRES records: (download)

>d4lyda_ c.69.1.0 (A:) automated matches {Sphingomonas wittichii [TaxId: 392499]}
mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay
dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignamggttacgaalkape
lidrlvlmgaavnispddmvanrddlaavmsydgseegmrkiiaalthsyqptddivhyr
heaslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqil
aipqaighvfpncghwvmieypeefctqtlhffgkl

Sequence, based on observed residues (ATOM records): (download)

>d4lyda_ c.69.1.0 (A:) automated matches {Sphingomonas wittichii [TaxId: 392499]}
mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay
dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignamggttacgaalkape
lidrlvlmgaavnispddmvanrydgseegmrkiiaalthsyqptddivhyrheaslrpt
ttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqilaipqaigh
vfpncghwvmieypeefctqtlhffgkl

SCOPe Domain Coordinates for d4lyda_:

Click to download the PDB-style file with coordinates for d4lyda_.
(The format of our PDB-style files is described here.)

Timeline for d4lyda_: