Lineage for d4lxga_ (4lxg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136645Species Sphingomonas wittichii [TaxId:392499] [227977] (5 PDB entries)
  8. 2136647Domain d4lxga_: 4lxg A: [227979]
    automated match to d2og1a_
    complexed with so4

Details for d4lxga_

PDB Entry: 4lxg (more details), 2.22 Å

PDB Description: crystal structure of dxnb2, a carbon - carbon bond hydrolase from sphingomonas wittichii rw1
PDB Compounds: (A:) MCP Hydrolase

SCOPe Domain Sequences for d4lxga_:

Sequence, based on SEQRES records: (download)

>d4lxga_ c.69.1.0 (A:) automated matches {Sphingomonas wittichii [TaxId: 392499]}
mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay
dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignsmggttacgaalkape
lidrlvlmgaavnispddmvanrddlaavmsydgseegmrkiiaalthsyqptddivhyr
heaslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqil
aipqaighvfpncghwvmieypeefctqtlhffgkl

Sequence, based on observed residues (ATOM records): (download)

>d4lxga_ c.69.1.0 (A:) automated matches {Sphingomonas wittichii [TaxId: 392499]}
mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay
dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignsmggttacgaalkape
lidrlvlmgaavnispddmvaddlaavmsydgseegmrkiiaalthsyqptddivhyrhe
aslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqilai
pqaighvfpncghwvmieypeefctqtlhffgkl

SCOPe Domain Coordinates for d4lxga_:

Click to download the PDB-style file with coordinates for d4lxga_.
(The format of our PDB-style files is described here.)

Timeline for d4lxga_: