Lineage for d4l7ha_ (4l7h A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060235Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2060236Species Human (Homo sapiens) [TaxId:9606] [50672] (281 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2060339Domain d4l7ha_: 4l7h A: [227973]
    automated match to d3kmxa_
    complexed with 1w1, act, dms

Details for d4l7ha_

PDB Entry: 4l7h (more details), 1.85 Å

PDB Description: Diethylaminosulfur Trifluoride-Mediated Intramolecular Cyclization of 2-hydroxy-benzylureas to Fused Bicyclic Aminooxazoline Compounds and Evaluation of Their Biochemical Activity Against Beta-Secretase-1 (BACE-1)
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d4l7ha_:

Sequence, based on SEQRES records: (download)

>d4l7ha_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiigg
idhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpk
kvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfri
tilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
chvhdefrtaavegpfvtldmedcgyni

Sequence, based on observed residues (ATOM records): (download)

>d4l7ha_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgaevlasvggsmiiggidhslyt
gslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaav
ksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqy
lrpvddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaaveg
pfvtldmedcgyni

SCOPe Domain Coordinates for d4l7ha_:

Click to download the PDB-style file with coordinates for d4l7ha_.
(The format of our PDB-style files is described here.)

Timeline for d4l7ha_: