Lineage for d4kbcb_ (4kbc B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218626Protein Casein kinase-1, CK1 [56139] (4 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. 2218632Species Human (Homo sapiens) [TaxId:9606] [224941] (14 PDB entries)
  8. 2218636Domain d4kbcb_: 4kbc B: [227966]
    automated match to d1ckia_
    complexed with 1qj, edo, so4

Details for d4kbcb_

PDB Entry: 4kbc (more details), 1.98 Å

PDB Description: ck1d in complex with {4-[3-(4-fluorophenyl)-1h-pyrazol-4-yl]pyridin-2-yl}methanol inhibitor
PDB Compounds: (B:) Casein kinase I isoform delta

SCOPe Domain Sequences for d4kbcb_:

Sequence, based on SEQRES records: (download)

>d4kbcb_ d.144.1.7 (B:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwn

Sequence, based on observed residues (ATOM records): (download)

>d4kbcb_ d.144.1.7 (B:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
melrvyrlgrkigsgsfgdiylgtdiaageevaiklekhpqlhieskiykmmqggvgipt
irwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihr
dvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlg
ieqsrrddleslgyvlmyfnlgslpwqglkyerisekkmstpievlckgypsefatylnf
crslrfddkpdysylrqlfrnlfhrqgfsydyvfdwn

SCOPe Domain Coordinates for d4kbcb_:

Click to download the PDB-style file with coordinates for d4kbcb_.
(The format of our PDB-style files is described here.)

Timeline for d4kbcb_: