Lineage for d3pckm_ (3pck M:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790808Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 790809Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 790969Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 790987Species Pseudomonas putida [TaxId:303] [49490] (21 PDB entries)
  8. 791054Domain d3pckm_: 3pck M: [22796]
    Other proteins in same PDB: d3pcka_, d3pckb_, d3pckc_, d3pckd_, d3pcke_, d3pckf_

Details for d3pckm_

PDB Entry: 3pck (more details), 2.13 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 6-hydroxynicotinic acid n-oxide
PDB Compounds: (M:) protocatechuate 3,4-dioxygenase

SCOP Domain Sequences for d3pckm_:

Sequence, based on SEQRES records: (download)

>d3pckm_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pckm_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOP Domain Coordinates for d3pckm_:

Click to download the PDB-style file with coordinates for d3pckm_.
(The format of our PDB-style files is described here.)

Timeline for d3pckm_: