SCOPe 2.03: Domain d4jvaa2: 4jva A:266-397

Lineage for d4jvaa2 (4jva A:266-397)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Regulatory subunit of Protein kinase A [51213] (2 species)
   duplication: consists of two similar domains

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [63861] (2 PDB entries)

8. Domain d4jvaa2: 4jva A:266-397 [227950]
   automated match to d1cx4a2
   complexed with 1or

Details for d4jvaa2

PDB Entry: 4jva, 2.5 Å

PDB Description: Crystal Structure of RIIbeta(108-402) bound to HE33, a N6 di-propyl substituted cAMP analog

PDB Compounds: (A:) cAMP-dependent protein kinase type II-beta regulatory subunit

SCOPe Domain Sequences for d4jvaa2:

Sequence, based on SEQRES records:

>d4jvaa2 b.82.3.2 (A:266-397) Regulatory subunit of Protein kinase A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsadsffivesgevritmkr
kgksdieengaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvqaferllgp
cmeimkrniaty

Sequence, based on observed residues (ATOM records):

>d4jvaa2 b.82.3.2 (A:266-397) Regulatory subunit of Protein kinase A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsadsffivesgevritmkr
kgkaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvqaferllgpcmeimkr
niaty

Timeline for d4jvaa2:

• d4jvaa2 is new in SCOPe 2.03-stable
  
• d4jvaa2 appears in SCOPe 2.04
  
• d4jvaa2 appears in the current release, SCOPe 2.08