Lineage for d4jvaa2 (4jva A:266-397)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2071306Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2071312Family b.82.3.2: cAMP-binding domain [51210] (13 protein domains)
    Pfam PF00027
  6. 2071431Protein Regulatory subunit of Protein kinase A [51213] (2 species)
    duplication: consists of two similar domains
  7. 2071445Species Norway rat (Rattus norvegicus) [TaxId:10116] [63861] (2 PDB entries)
  8. 2071449Domain d4jvaa2: 4jva A:266-397 [227950]
    automated match to d1cx4a2
    complexed with 1or

Details for d4jvaa2

PDB Entry: 4jva (more details), 2.5 Å

PDB Description: Crystal Structure of RIIbeta(108-402) bound to HE33, a N6 di-propyl substituted cAMP analog
PDB Compounds: (A:) cAMP-dependent protein kinase type II-beta regulatory subunit

SCOPe Domain Sequences for d4jvaa2:

Sequence, based on SEQRES records: (download)

>d4jvaa2 b.82.3.2 (A:266-397) Regulatory subunit of Protein kinase A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsadsffivesgevritmkr
kgksdieengaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvqaferllgp
cmeimkrniaty

Sequence, based on observed residues (ATOM records): (download)

>d4jvaa2 b.82.3.2 (A:266-397) Regulatory subunit of Protein kinase A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsadsffivesgevritmkr
kgkaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvqaferllgpcmeimkr
niaty

SCOPe Domain Coordinates for d4jvaa2:

Click to download the PDB-style file with coordinates for d4jvaa2.
(The format of our PDB-style files is described here.)

Timeline for d4jvaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jvaa1