Lineage for d4jvaa1 (4jva A:127-265)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1331405Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1331411Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 1331521Protein Regulatory subunit of Protein kinase A [51213] (2 species)
    duplication: consists of two similar domains
  7. 1331535Species Norway rat (Rattus norvegicus) [TaxId:10116] [63861] (2 PDB entries)
  8. 1331538Domain d4jvaa1: 4jva A:127-265 [227949]
    automated match to d1cx4a1
    complexed with 1or

Details for d4jvaa1

PDB Entry: 4jva (more details), 2.5 Å

PDB Description: Crystal Structure of RIIbeta(108-402) bound to HE33, a N6 di-propyl substituted cAMP analog
PDB Compounds: (A:) cAMP-dependent protein kinase type II-beta regulatory subunit

SCOPe Domain Sequences for d4jvaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jvaa1 b.82.3.2 (A:127-265) Regulatory subunit of Protein kinase A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aesriihpktddqrnrlqeackdillfknldpeqmsqvldamfeklvkegehvidqgddg
dnfyvidrgtfdiyvkcdgvgrcvgnydnrgsfgelalmyntpraatitatspgalwgld
rvtfrriivknnakkrkmy

SCOPe Domain Coordinates for d4jvaa1:

Click to download the PDB-style file with coordinates for d4jvaa1.
(The format of our PDB-style files is described here.)

Timeline for d4jvaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jvaa2