Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein Regulatory subunit of Protein kinase A [51213] (2 species) duplication: consists of two similar domains |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [63861] (2 PDB entries) |
Domain d4jvaa1: 4jva A:127-265 [227949] automated match to d1cx4a1 complexed with 1or |
PDB Entry: 4jva (more details), 2.5 Å
SCOPe Domain Sequences for d4jvaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jvaa1 b.82.3.2 (A:127-265) Regulatory subunit of Protein kinase A {Norway rat (Rattus norvegicus) [TaxId: 10116]} aesriihpktddqrnrlqeackdillfknldpeqmsqvldamfeklvkegehvidqgddg dnfyvidrgtfdiyvkcdgvgrcvgnydnrgsfgelalmyntpraatitatspgalwgld rvtfrriivknnakkrkmy
Timeline for d4jvaa1: