Lineage for d4ifoa_ (4ifo A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442579Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
    Pfam PF04909; Amidohydrolase; stand-alone domain
  6. 2442580Protein 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD [141824] (1 species)
  7. 2442581Species Pseudomonas fluorescens [TaxId:294] [141825] (14 PDB entries)
    Uniprot Q83V25 3-333
  8. 2442601Domain d4ifoa_: 4ifo A: [227939]
    automated match to d2hbva1
    complexed with zn

Details for d4ifoa_

PDB Entry: 4ifo (more details), 2.5 Å

PDB Description: 2.50 Angstroms X-ray crystal structure of R51A 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase from Pseudomonas fluorescens
PDB Compounds: (A:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase

SCOPe Domain Sequences for d4ifoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ifoa_ c.1.9.15 (A:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]}
kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfapvyqalwdpaf
rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgrvdn
awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
kigglvlssnlgesakdkiisgnaskffnin

SCOPe Domain Coordinates for d4ifoa_:

Click to download the PDB-style file with coordinates for d4ifoa_.
(The format of our PDB-style files is described here.)

Timeline for d4ifoa_: