SCOPe 2.06: Domain d4hwpb2: 4hwp B:533-639

Lineage for d4hwpb2 (4hwp B:533-639)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.0: automated matches [227929] (1 protein)
   not a true family

6. Protein automated matches [227930] (3 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [227937] (6 PDB entries)

8. Domain d4hwpb2: 4hwp B:533-639 [227938]
   Other proteins in same PDB: d4hwpa1, d4hwpa3, d4hwpb1
   automated match to d1qf6a1
   protein/RNA complex; complexed with x16, zn

Details for d4hwpb2

PDB Entry: 4hwp, 1.81 Å

PDB Description: Crystal structure of E. coli Threonyl-tRNA synthetase bound to a novel inhibitor

PDB Compounds: (B:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4hwpb2:

Sequence; same for both SEQRES and ATOM records:

>d4hwpb2 c.51.1.0 (B:533-639) automated matches {Escherichia coli K-12 [TaxId: 83333]}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkq

Timeline for d4hwpb2:

• d4hwpb2 first appeared in SCOPe 2.03
  
• d4hwpb2 appears in SCOPe 2.05
  
• d4hwpb2 appears in SCOPe 2.07
  
• d4hwpb2 appears in the current release, SCOPe 2.08