SCOPe 2.06: Domain d4hwtb1: 4hwt B:354-644

Lineage for d4hwtb1 (4hwt B:354-644)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225403] (8 PDB entries)

8. Domain d4hwtb1: 4hwt B:354-644 [227933]
   Other proteins in same PDB: d4hwta2, d4hwtb2
   automated match to d1qf6a4
   protein/RNA complex; complexed with 1b2, zn

Details for d4hwtb1

PDB Entry: 4hwt, 2.3 Å

PDB Description: Crystal structure of human Threonyl-tRNA synthetase bound to a novel inhibitor

PDB Compounds: (B:) Threonine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4hwtb1:

Sequence; same for both SEQRES and ATOM records:

>d4hwtb1 d.104.1.0 (B:354-644) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifns
rlwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvl
hrnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlst
rpekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcat
iqldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggk

Timeline for d4hwtb1:

• d4hwtb1 first appeared in SCOPe 2.03
  
• d4hwtb1 appears in SCOPe 2.05
  
• d4hwtb1 appears in SCOPe 2.07
  
• d4hwtb1 appears in the current release, SCOPe 2.08