SCOPe 2.03: Domain d4hwta2: 4hwt A:645-752

Lineage for d4hwta2 (4hwt A:645-752)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.0: automated matches [227929] (1 protein)
   not a true family

6. Protein automated matches [227930] (2 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [227931] (1 PDB entry)

8. Domain d4hwta2: 4hwt A:645-752 [227932]
   Other proteins in same PDB: d4hwta1, d4hwtb1
   automated match to d1qf6a1
   protein/RNA complex; complexed with 1b2, zn

Details for d4hwta2

PDB Entry: 4hwt, 2.3 Å

PDB Description: Crystal structure of human Threonyl-tRNA synthetase bound to a novel inhibitor

PDB Compounds: (A:) Threonine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4hwta2:

Sequence; same for both SEQRES and ATOM records:

>d4hwta2 c.51.1.0 (A:645-752) automated matches {Homo sapiens [TaxId: 9606]}
wpfwlsprqvmvvpvgptcdeyaqkvrqqfhdakfmadidldpgctlnkkirnaqlaqyn
filvvgekekisgtvnirtrdnkvhgertisetierlqqlkefrskqa

Timeline for d4hwta2:

• d4hwta2 is new in SCOPe 2.03-stable
  
• d4hwta2 appears in SCOPe 2.04
  
• d4hwta2 appears in the current release, SCOPe 2.08