Lineage for d4hwta1 (4hwt A:354-644)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426347Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1426348Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1426693Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 1426694Protein automated matches [226887] (7 species)
    not a true protein
  7. 1426704Species Human (Homo sapiens) [TaxId:9606] [225403] (4 PDB entries)
  8. 1426711Domain d4hwta1: 4hwt A:354-644 [227928]
    Other proteins in same PDB: d4hwta2, d4hwtb2
    automated match to d1qf6a4
    protein/RNA complex; complexed with 1b2, zn

Details for d4hwta1

PDB Entry: 4hwt (more details), 2.3 Å

PDB Description: Crystal structure of human Threonyl-tRNA synthetase bound to a novel inhibitor
PDB Compounds: (A:) Threonine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4hwta1:

Sequence, based on SEQRES records: (download)

>d4hwta1 d.104.1.0 (A:354-644) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifns
rlwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvl
hrnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlst
rpekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcat
iqldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggk

Sequence, based on observed residues (ATOM records): (download)

>d4hwta1 d.104.1.0 (A:354-644) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifns
rlwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvl
hrnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlst
rpekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcat
iqldfqlpirfnltyvsdkkrpvivhrailgsvermiailtenyggk

SCOPe Domain Coordinates for d4hwta1:

Click to download the PDB-style file with coordinates for d4hwta1.
(The format of our PDB-style files is described here.)

Timeline for d4hwta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hwta2