SCOPe 2.03: Domain d4gune1: 4gun E:2-89

Lineage for d4gune1 (4gun E:2-89)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (26 species)
   not a true protein

7. Species Yeast (Candida albicans) [TaxId:5476] [226297] (2 PDB entries)

8. Domain d4gune1: 4gun E:2-89 [227919]
   Other proteins in same PDB: d4guna2, d4gunb2, d4gunc2, d4gund2, d4gune2, d4gunf2, d4gung2, d4gunh2, d4guni2, d4gunj2, d4gunk2, d4gunl2, d4gunm2, d4gunn2, d4guno2, d4gunp2
   automated match to d3qvna1
   complexed with mn, so4; mutant

Details for d4gune1

PDB Entry: 4gun, 1.94 Å

PDB Description: Crystal Structure of the K184R, L185P mutant manganese superoxide dismutase from Candida albicans cytosol

PDB Compounds: (E:) superoxide dismutase

SCOPe Domain Sequences for d4gune1:

Sequence; same for both SEQRES and ATOM records:

>d4gune1 a.2.11.0 (E:2-89) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
svveiqqnikfhggghtnhslfwknlap

Timeline for d4gune1:

• d4gune1 is new in SCOPe 2.03-stable
  
• d4gune1 appears in SCOPe 2.04
  
• d4gune1 appears in the current release, SCOPe 2.08