Lineage for d4fhaa_ (4fha A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086927Species Streptococcus pneumoniae [TaxId:406556] [226690] (3 PDB entries)
  8. 2086928Domain d4fhaa_: 4fha A: [227917]
    automated match to d3vfla_
    complexed with lys, na

Details for d4fhaa_

PDB Entry: 4fha (more details), 1.88 Å

PDB Description: Structure of Dihydrodipicolinate Synthase from Streptococcus pneumoniae,bound to pyruvate and lysine
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d4fhaa_:

Sequence, based on SEQRES records: (download)

>d4fhaa_ c.1.10.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 406556]}
syqdlkeckiitafitpfhedgsinfdaipaliehllahhtdgillagttaesptlthde
elelfaavqkvvngrvpliagvgtndtrdsiefvkevaefggfaaglaivpyynkpsqeg
myqhfkaiadasdlpiiiynipgrvvveltpetmlrladhpniigvxectslanmaylie
hkpeefliytgedgdafhamnlgadgvisvashtngdemhemftaiaesdmkkaaaiqrk
fipkvnalfsypspapvkailnymgfeagptrlplvpapeedvkriikvvvdgdyeatka
tvtgvlrpdy

Sequence, based on observed residues (ATOM records): (download)

>d4fhaa_ c.1.10.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 406556]}
syqdlkeckiitafitpfhedgsinfdaipaliehllahhtdgillagttaesptlthde
elelfaavqkvvngrvpliagvgtndtrdsiefvkevaefggfaaglaivpyynkpsqeg
myqhfkaiadasdlpiiiynipgrvvveltpetmlrladhpniigvxectslanmaylie
hkpeefliytgedgdafhamnlgadgvisvashtngdemhemftaiaesdmkkaaaiqrk
fipkvnalfsypspapvkailnymgfeagptrlplvpapeedvkriikvvvdgdyeatvt
gvlrpdy

SCOPe Domain Coordinates for d4fhaa_:

Click to download the PDB-style file with coordinates for d4fhaa_.
(The format of our PDB-style files is described here.)

Timeline for d4fhaa_: