Class b: All beta proteins [48724] (174 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein automated matches [190163] (12 species) not a true protein |
Species Rhodnius prolixus [TaxId:13249] [187425] (3 PDB entries) |
Domain d4gnwa_: 4gnw A: [227915] automated match to d1sy3a_ complexed with hem, nh3, po4; mutant |
PDB Entry: 4gnw (more details), 1.15 Å
SCOPe Domain Sequences for d4gnwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gnwa_ b.60.1.1 (A:) automated matches {Rhodnius prolixus [TaxId: 13249]} actknaiaqtgfnkdkyfngdvwyvtdylnlqpdnvpkrycaalaagtasgklkealyhy dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks lltk
Timeline for d4gnwa_: