Lineage for d3vx1a2 (3vx1 A:382-477)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810567Protein Fungal alpha-amylase [51028] (2 species)
  7. 2810570Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries)
  8. 2810577Domain d3vx1a2: 3vx1 A:382-477 [227910]
    Other proteins in same PDB: d3vx1a1
    automated match to d2guya1
    complexed with ca, nag

Details for d3vx1a2

PDB Entry: 3vx1 (more details), 2.2 Å

PDB Description: crystal structure of alpha-amylase from aspergillus oryzae
PDB Compounds: (A:) Alpha-amylase A type-1/2

SCOPe Domain Sequences for d3vx1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vx1a2 b.71.1.1 (A:382-477) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskicss

SCOPe Domain Coordinates for d3vx1a2:

Click to download the PDB-style file with coordinates for d3vx1a2.
(The format of our PDB-style files is described here.)

Timeline for d3vx1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vx1a1