![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Fungal alpha-amylase [51028] (2 species) |
![]() | Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries) |
![]() | Domain d3vx0a2: 3vx0 A:382-475 [227908] Other proteins in same PDB: d3vx0a1 automated match to d2guya1 complexed with ca, gd, nag |
PDB Entry: 3vx0 (more details), 1.5 Å
SCOPe Domain Sequences for d3vx0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vx0a2 b.71.1.1 (A:382-475) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct tvtvgsdgnvpvpmagglprvlypteklagskic
Timeline for d3vx0a2: