![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species) secreted during involution |
![]() | Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (9 PDB entries) Uniprot Q7YS85 |
![]() | Domain d4mava2: 4mav A:241-308 [227906] Other proteins in same PDB: d4mava1 automated match to d2o9oa2 complexed with gol, nag, rib |
PDB Entry: 4mav (more details), 2.79 Å
SCOPe Domain Sequences for d4mava2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mava2 d.26.3.1 (A:241-308) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]} grsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatk gnqwvayd
Timeline for d4mava2: