Lineage for d4ldca1 (4ldc A:265-412)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382506Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2382773Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2382774Protein automated matches [190497] (4 species)
    not a true protein
  7. 2382819Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (11 PDB entries)
  8. 2382820Domain d4ldca1: 4ldc A:265-412 [227898]
    Other proteins in same PDB: d4ldca2
    automated match to d1uova_
    complexed with ca, flc

Details for d4ldca1

PDB Entry: 4ldc (more details), 1.26 Å

PDB Description: Crystal Structure of DOC2B C2B domain
PDB Compounds: (A:) Double C2-like domain-containing protein beta

SCOPe Domain Sequences for d4ldca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ldca1 b.7.1.0 (A:265-412) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eergrilislkyssqkqgllvgivrcahlaamdangysdpyvktylkpdvdkkskhktav
kkktlnpefneefcyeikhgdlakktlevtvwdydigksndfiggvvlginakgerlkhw
fdclknkdkrierwhtltneipgavlsd

SCOPe Domain Coordinates for d4ldca1:

Click to download the PDB-style file with coordinates for d4ldca1.
(The format of our PDB-style files is described here.)

Timeline for d4ldca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ldca2