Class b: All beta proteins [48724] (176 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
Protein automated matches [190497] (4 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (8 PDB entries) |
Domain d4ldca_: 4ldc A: [227898] automated match to d1uova_ complexed with ca, flc |
PDB Entry: 4ldc (more details), 1.26 Å
SCOPe Domain Sequences for d4ldca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ldca_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} geergrilislkyssqkqgllvgivrcahlaamdangysdpyvktylkpdvdkkskhkta vkkktlnpefneefcyeikhgdlakktlevtvwdydigksndfiggvvlginakgerlkh wfdclknkdkrierwhtltneipgavlsd
Timeline for d4ldca_: