Lineage for d4ldca_ (4ldc A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304037Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1304038Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1304196Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 1304197Protein automated matches [190497] (3 species)
    not a true protein
  7. 1304212Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (8 PDB entries)
  8. 1304213Domain d4ldca_: 4ldc A: [227898]
    automated match to d1uova_
    complexed with ca, flc

Details for d4ldca_

PDB Entry: 4ldc (more details), 1.26 Å

PDB Description: Crystal Structure of DOC2B C2B domain
PDB Compounds: (A:) Double C2-like domain-containing protein beta

SCOPe Domain Sequences for d4ldca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ldca_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
geergrilislkyssqkqgllvgivrcahlaamdangysdpyvktylkpdvdkkskhkta
vkkktlnpefneefcyeikhgdlakktlevtvwdydigksndfiggvvlginakgerlkh
wfdclknkdkrierwhtltneipgavlsd

SCOPe Domain Coordinates for d4ldca_:

Click to download the PDB-style file with coordinates for d4ldca_.
(The format of our PDB-style files is described here.)

Timeline for d4ldca_: