![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
![]() | Protein automated matches [190497] (4 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (10 PDB entries) |
![]() | Domain d4ldca1: 4ldc A:265-412 [227898] Other proteins in same PDB: d4ldca2 automated match to d1uova_ complexed with ca, flc |
PDB Entry: 4ldc (more details), 1.26 Å
SCOPe Domain Sequences for d4ldca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ldca1 b.7.1.0 (A:265-412) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} eergrilislkyssqkqgllvgivrcahlaamdangysdpyvktylkpdvdkkskhktav kkktlnpefneefcyeikhgdlakktlevtvwdydigksndfiggvvlginakgerlkhw fdclknkdkrierwhtltneipgavlsd
Timeline for d4ldca1: