Lineage for d4l5ob2 (4l5o B:81-217)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1736416Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1736417Protein automated matches [226831] (51 species)
    not a true protein
  7. 1736528Species Clonorchis sinensis [TaxId:79923] [225958] (3 PDB entries)
  8. 1736532Domain d4l5ob2: 4l5o B:81-217 [227890]
    Other proteins in same PDB: d4l5oa1, d4l5ob1, d4l5oc1
    automated match to d3isoa2
    complexed with gsh, so4, zn; mutant

Details for d4l5ob2

PDB Entry: 4l5o (more details), 2.09 Å

PDB Description: crystal structure of 26 kda gst d26h mutant of clonorchis sinensis
PDB Compounds: (B:) putative glutathione transferase

SCOPe Domain Sequences for d4l5ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l5ob2 a.45.1.0 (B:81-217) automated matches {Clonorchis sinensis [TaxId: 79923]}
migntpverakismiegglvdlragvsriayqetfeqlkvpylqqlpstlrmwsqflgnn
sylhgstpthldfmfyealdviryldptsveafpnlmqfihriealpnikafmesdrfik
wplngwsayfgggdapp

SCOPe Domain Coordinates for d4l5ob2:

Click to download the PDB-style file with coordinates for d4l5ob2.
(The format of our PDB-style files is described here.)

Timeline for d4l5ob2: