| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (188 species) not a true protein |
| Species Clonorchis sinensis [TaxId:79923] [225957] (3 PDB entries) |
| Domain d4l5ob1: 4l5o B:1-80 [227889] Other proteins in same PDB: d4l5oa2, d4l5ob2, d4l5oc2 automated match to d3isoa1 complexed with gsh, so4, zn; mutant |
PDB Entry: 4l5o (more details), 2.09 Å
SCOPe Domain Sequences for d4l5ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l5ob1 c.47.1.0 (B:1-80) automated matches {Clonorchis sinensis [TaxId: 79923]}
mapvlgywkirglaqpirllleyvghsyeehsygrcdgekwqndkhnlglelpnlpyykd
gnfsltqslailryiadkhn
Timeline for d4l5ob1:
View in 3DDomains from other chains: (mouse over for more information) d4l5oa1, d4l5oa2, d4l5oc1, d4l5oc2 |