Lineage for d4l9nb1 (4l9n B:2-139)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695060Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries)
  8. 2695066Domain d4l9nb1: 4l9n B:2-139 [227888]
    Other proteins in same PDB: d4l9nb2
    automated match to d3jw4b_
    complexed with so4; mutant

Details for d4l9nb1

PDB Entry: 4l9n (more details), 1.6 Å

PDB Description: crystal structure of mepr a103v mutant from multidrug resistant s. aureus clinical isolate
PDB Compounds: (B:) MepR

SCOPe Domain Sequences for d4l9nb1:

Sequence, based on SEQRES records: (download)

>d4l9nb1 a.4.5.0 (B:2-139) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklvevftsifdemeqtlvsqlse
eeneqmkanltkmlsslq

Sequence, based on observed residues (ATOM records): (download)

>d4l9nb1 a.4.5.0 (B:2-139) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdqdtrrkniglttsgiklvevftsifdemeqtlvsqlsee
eneqmkanltkmlsslq

SCOPe Domain Coordinates for d4l9nb1:

Click to download the PDB-style file with coordinates for d4l9nb1.
(The format of our PDB-style files is described here.)

Timeline for d4l9nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l9nb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4l9na_