Lineage for d4l9na_ (4l9n A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260280Species Staphylococcus aureus [TaxId:1280] [193082] (5 PDB entries)
  8. 1260281Domain d4l9na_: 4l9n A: [227887]
    automated match to d3jw4b_
    complexed with so4; mutant

Details for d4l9na_

PDB Entry: 4l9n (more details), 1.6 Å

PDB Description: crystal structure of mepr a103v mutant from multidrug resistant s. aureus clinical isolate
PDB Compounds: (A:) MepR

SCOPe Domain Sequences for d4l9na_:

Sequence, based on SEQRES records: (download)

>d4l9na_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklvevftsifdemeqtlvsqlse
eeneqmkanltkmlsslq

Sequence, based on observed residues (ATOM records): (download)

>d4l9na_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdaqdtrkniglttsgiklvevftsifdemeqtlvsqlsee
eneqmkanltkmlsslq

SCOPe Domain Coordinates for d4l9na_:

Click to download the PDB-style file with coordinates for d4l9na_.
(The format of our PDB-style files is described here.)

Timeline for d4l9na_: