SCOPe 2.03: Domain d4l9na_: 4l9n A:

Lineage for d4l9na_ (4l9n A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (41 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [193082] (5 PDB entries)

8. Domain d4l9na_: 4l9n A: [227887]
   automated match to d3jw4b_
   complexed with so4; mutant

Details for d4l9na_

PDB Entry: 4l9n, 1.6 Å

PDB Description: crystal structure of mepr a103v mutant from multidrug resistant s. aureus clinical isolate

PDB Compounds: (A:) MepR

SCOPe Domain Sequences for d4l9na_:

Sequence, based on SEQRES records:

>d4l9na_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklvevftsifdemeqtlvsqlse
eeneqmkanltkmlsslq

Sequence, based on observed residues (ATOM records):

>d4l9na_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdaqdtrkniglttsgiklvevftsifdemeqtlvsqlsee
eneqmkanltkmlsslq

Timeline for d4l9na_:

• d4l9na_ is new in SCOPe 2.03-stable
  
• d4l9na_ appears in SCOPe 2.04
  
• d4l9na_ appears in the current release, SCOPe 2.08