![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (41 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [193082] (5 PDB entries) |
![]() | Domain d4l9na_: 4l9n A: [227887] automated match to d3jw4b_ complexed with so4; mutant |
PDB Entry: 4l9n (more details), 1.6 Å
SCOPe Domain Sequences for d4l9na_:
Sequence, based on SEQRES records: (download)
>d4l9na_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklvevftsifdemeqtlvsqlse eeneqmkanltkmlsslq
>d4l9na_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg ptvsnllrnlerkkliyryvdaqdtrkniglttsgiklvevftsifdemeqtlvsqlsee eneqmkanltkmlsslq
Timeline for d4l9na_: